Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr12560gudDXFF4834R_chr12560probable glucarate dehydratase-related protein

gudD XFF4834R_chr12560
XFF4834R_chr12550
XFF4834R_chr12550
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr12570
XFF4834R_chr12570
ID gudD
AC XFF4834R_chr12560
LT XFF4834R_chr12560
OR XFF4834R_chr from 1422584 to 1423939 on strand +
DE probable glucarate dehydratase-related protein
IP Glucarate dehydratase
CL 1.1.1.6 D-glucarate catabolism GO:0042838
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: glucarate catabolic process (GO:0019394)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: glucarate dehydratase activity (GO:0008872)
Molecular Function: magnesium ion binding (GO:0000287)

Curated
PM
AN
CC COG: [MR] Cell wall/membrane/envelope biogenesis;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100823)
MW 48971.9 Da
SQ 451 aa
 
........10........20........30........40........50
| | | | |
MNSHTSSAGMGTTPRVTDVRVVPVAGQDSMLLNLSGAHAPYFTRNVLVLR
DSSGRIGVGEVPGGAAIAGLLNEAAALIRDRSIADYQRILNQVRTAFADR
DSAGRGLQTFDLRITIHAVTAIEAALLDLLGQFLDQPVAALLGEGQQRDA
VDVLGYLFFIGDRRKTGLDYRDGSAASDAWEAVRDQEALTPAAVMRLAEA
AYEKYGFRDFKLKGGVLRGEDEIEAIHALHARFPQARITLDPNGAWSLAQ
AIALCRDMHGVMAYAEDPCGAEQGYSGREVMAEFRRATGLPTATNMIATD
WRQMGHAIQLQSVDIPLADPHFWTLQGSVRVAQLCRDWGLTWGSHSNNHF
DISLAMFTHVAAAAPGQVTAIDTHWIWQDGQRLTRNPLQIAGGRITVPAK
PGLGVELDMDALDAAHRTYQSLSLGARDDAAAMQALIPNWTFDNKRPCLV
R
XFF4834R

NP_638588.1 lcl|tcbD-XCC3242

1

451

S=1983 I=84 E=0

glucarate hydratase

pubmed

25

451

S=1665 I=74 E=0

Glucarate dehydratase EC=4.2.1.40 ; Lyase Magnesium Metal-binding

Pubmed 9772161

 

prodomImg

pubmed

25

451

S=1585 I=70 E=0

Probable glucarate dehydratase EC=4.2.1.40 ; Lyase Magnesium Metal-binding

Pubmed 7704254

 

prodomImg

pubmed

209

417

S=133 I=27 E=3.34067e-07

Muconate cycloisomerase 1 EC=5.5.1.1 ; Aromatic hydrocarbons catabolism Manganese Metal-binding

Pubmed 8990288

 

prodomImg

pubmed

181

412

S=128 I=28 E=1.26814e-06

Muconate cycloisomerase EC=5.5.1.1

Pubmed 17483937

 

prodomImg

pubmed

196

417

S=125 I=27 E=2.63776e-06

Cis,cis-muconate cycloisomerase EC=5.5.1.1

Pubmed 9034312

 

prodomImg

sp_Pdown

sp|P42206|GUDH_PSEPU

25

451

S=1665 I=74 E=0

Glucarate dehydratase EC=4.2.1.40 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|P0AES2|GUDH_ECOLI

25

451

S=1600 I=68 E=0

Glucarate dehydratase EC=4.2.1.40 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|P0AES3|GUDH_ECO57

25

451

S=1600 I=68 E=0

Glucarate dehydratase EC=4.2.1.40 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|P42238|GUDH_BACSU

25

451

S=1585 I=70 E=0

Probable glucarate dehydratase EC=4.2.1.40 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|Q46915|GUDX_ECOLI

25

451

S=1334 I=61 E=5.77395e-153

Glucarate dehydratase-related protein EC=4.2.1.- ; Lyase Magnesium Metal-binding

Iprscan [G3DSA:3.30.390.10]

14

143

-

Iprscan [G3DSA:3.20.20.120]

144

403

-

Iprscan [PTHR13794:SF6]

114

450

-

Iprscan IPR001354 [PTHR13794]

114

450

Mandelate racemase/muconate lactonizing enzyme

Iprscan IPR013342 [PF01188]

191

290

Mandelate racemase/muconate lactonizing enzyme, C-terminal

Iprscan IPR017653 [TIGR03247]

11

451

Glucarate dehydratase

Iprscan [seg]

12

24

-

Iprscan [seg]

63

77

-

PDA5O9Z0

261

299

S=170 I=74 E=4.719e-13

PD394930

25

62

S=167 I=76 E=9.64592e-13

PD017864

137

189

S=163 I=61 E=3.10267e-12

PDA1G303

415

451

S=154 I=76 E=4.35558e-11

PD906285

81

134

S=149 I=73 E=1.75747e-10

PDA1G302

300

324

S=136 I=96 E=6.43745e-09

PD003216

137

269

S=123 I=33 E=2.5728e-07

Iprscan [SSF51604]

144

422

-

Iprscan [SSF54826]

11

143

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one cig6CRyV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

7 hits
swiss-prot

Swiss-Prot ncbi-blastp

8 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4v8ftq/XFF4834R_chr12560.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4v8ftq/XFF4834R_chr12560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4v8ftq/XFF4834R_chr12560.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4v8ftq/XFF4834R_chr12560.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.