Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr12580garDXFF4834R_chr12580probable D-galactarate dehydratase

garD XFF4834R_chr12580
XFF4834R_chr12570
XFF4834R_chr12570
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr12590
XFF4834R_chr12590
ID garD
AC XFF4834R_chr12580
LT XFF4834R_chr12580
OR XFF4834R_chr from 1425324 to 1426865 on strand +
DE probable D-galactarate dehydratase
IP Galactarate dehydratase
CL 1.1.1.25 L-ascorbate degradation GO:0019854
EC
GO InterPro
Molecular Function: hydro-lyase activity (GO:0016836)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 54303.4 Da
SQ 513 aa
 
........10........20........30........40........50
| | | | |
MSATQQPTHWLSIRAHARDNVAIVVNDDGAPAGAIFPDGLTAIEHIPQGH
KMALVDLPAGAAVIRLGAVIGTANAAIARGAWVSEPLLDMPEAPELATLD
LSLHPAQESEPLEGYTFQGYRNRDGSVGTRNILGIMTSVQCVVGVLGHAV
ERIRAELLPRYPNVDDVVAVNHVYGCGVAITAPEAIIPIRTLRNIARSPN
FGGQALIVGLGCEKLAPERLLPDDAGADDSAVYRLQEASLGFADMVGSIM
AMAEERLRHLDLRRRETVPASELVVGMQCGGSDAFSGVTANPGLGVAADL
LVRAGATVMFSENTEVRDGIHLLVPRAANADVAKALLREMAWYDTYLARG
QADRSANTTPGNKKGGLANIVEKAMGSIAKSGSSVINGVVPPGERVKGRG
LQYCATPASDFVCGTLQVAAGMNLHVFTTGRGTPYGLGMVPVIKVATRSE
LAQRWSDLMDIDAGGVATGAKTLEELGWELFQRYLDVASGQRTWTEQHRL
HNDLALFNPAPIT
XFF4834R

NP_638586.2 lcl|XCC3240

1

513

S=2322 I=87 E=0

D-galactarate dehydratase

pubmed

11

513

S=1636 I=61 E=0

Probable D-galactarate dehydratase EC=4.2.1.42 ; Lyase

Pubmed 7704254

 

prodomImg

pubmed

40

496

S=632 I=36 E=1.24191e-67

D-galactarate dehydratase/altronate hydrolase family protein EC=4.2.1.- ; Lyase

Pubmed 18043661

 

prodomImg

pubmed

350

512

S=553 I=64 E=4.21428e-58

Putative uncharacterized protein

Pubmed 15292145

 

prodomImg

pubmed

13

507

S=541 I=31 E=1.23055e-56

Altronate hydrolase EC=4.2.1.7 ; Lyase

Pubmed 9579062

 

prodomImg

pubmed

269

510

S=282 I=32 E=3.02153e-25

Sulfolactate sulfo-lyase large subunit

Pubmed 15758220

 

prodomImg

sp_Pdown

sp|P39829|GARD_ECOLI

5

513

S=1649 I=62 E=0

D-galactarate dehydratase EC=4.2.1.42 ; Lyase

sp_Pdown

sp|P42240|GARD_BACSU

11

513

S=1636 I=61 E=0

Probable D-galactarate dehydratase EC=4.2.1.42 ; Lyase

sp_Pdown

sp|O34673|UXAA_BACSU

13

507

S=541 I=31 E=8.37026e-57

Altronate hydrolase EC=4.2.1.7 ; Lyase

sp_Pdown

sp|P42604|UXAA_ECOLI

13

507

S=530 I=32 E=2.0891e-55

Altronate hydrolase EC=4.2.1.7 ; Iron Lyase Manganese

Iprscan IPR007392 [PF04295]

114

511

D-galactarate dehydratase/Altronate hydrolase, C-terminal

Iprscan IPR013974 [PF08666]

19

85

SAF domain

Iprscan IPR013974 [SM00858]

19

89

SAF domain

Iprscan IPR017654 [TIGR03248]

11

513

Galactarate dehydratase

Iprscan [seg]

254

266

-

PD870786

117

347

S=491 I=47 E=6.43364e-52

PDA917N7

163

222

S=254 I=75 E=3.15359e-23

PDA1F922

446

507

S=186 I=56 E=5.52111e-15

PDA2E503

119

162

S=181 I=75 E=2.45199e-14

PDA1F911

354

414

S=155 I=55 E=3.95083e-11

PDA30317

1

40

S=143 I=70 E=1.12385e-09

PD016374

40

83

S=126 I=57 E=1.1517e-07

PDA917O0

12

141

S=114 I=30 E=3.21948e-06

PDA1H0T8

11

40

S=109 I=70 E=1.45496e-05

PD017783

415

446

S=107 I=72 E=2.08016e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one VLeIgp5L)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

4 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRRDsfV/XFF4834R_chr12580.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRRDsfV/XFF4834R_chr12580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRRDsfV/XFF4834R_chr12580.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBRRDsfV/XFF4834R_chr12580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.