Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr01930gpsAXFF4834R_chr01930probable Glycerol-3-phosphate dehydrogenase [NAD(P)+]
  2. XFF4834R_chr03420glpKXFF4834R_chr03420probable glycerol kinase
  3. XFF4834R_chr27460dgoAXFF4834R_chr27460putative 2-dehydro-3-deoxy-6-phosphogalactonate aldolase
  4. XFF4834R_chr27490dgoKXFF4834R_chr27490putative 2-oxo-3-deoxygalactonate kinase

gpsA XFF4834R_chr01930
XFF4834R_chr01920
XFF4834R_chr01920
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01940
XFF4834R_chr01940
ID gpsA
AC XFF4834R_chr01930
LT XFF4834R_chr01930
OR XFF4834R_chr from 228590 to 229615 on strand +
DE probable Glycerol-3-phosphate dehydrogenase [NAD(P)+]
IP NAD-dependent glycerol-3-phosphate dehydrogenase, C-terminal; NAD-dependent glycerol-3-phosphate dehydrogenase, N-terminal
CL 1.1.1.23 Galactose degradation GO:0019388
EC
GO InterPro
Biological Process: glycerol-3-phosphate metabolic process (GO:0006072)
Biological Process: metabolic process (GO:0008152)
Biological Process: carbohydrate metabolic process (GO:0005975)
Biological Process: glycerol-3-phosphate catabolic process (GO:0046168)
Biological Process: oxidation reduction (GO:0055114)
Cellular Component: cytoplasm (GO:0005737)
Cellular Component: glycerol-3-phosphate dehydrogenase complex (GO:0009331)
Molecular Function: NAD or NADH binding (GO:0051287)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: coenzyme binding (GO:0050662)
Molecular Function: glycerol-3-phosphate dehydrogenase (NAD+) activity (GO:0004367)
Molecular Function: binding (GO:0005488)
NAD or NADP as acceptor (GO:0016616)
acting on CH-OH group of donors (GO:0016614)

Curated
PM
AN start changed to match XAC, XCV & XCC
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100423)
MW 35798.8 Da
SQ 341 aa
 
........10........20........30........40........50
| | | | |
MSDLTHKIAVLGAGSWGTALAALLARHGHPTVLWGRDAAMVDTIDRTHEN
ARYLPGIALPDSLRATTDLQAAVADATWILVVVPSHAFTETIRLIAPLRP
AGAGVAWATKGFEPGSGRFLHEVARDILGPSVPLAVVTGPSFAKEVTLGL
PTAITVHGDDAAFAQVVADAMHGPTFRAYTGDDMVGAELGGAMKNVLAVA
TGVADGMQLGLNARAGLITRGLNEMLRLAAVIGARPETLMGLAGLGDLVL
TCTGDLSRNRRLGLALGRGQSLDEAIREIGQVVESVQTADEVMRQAEHHG
IELPISNAVRAVLHGEITPEAGLKELLARERKPEYPQTLFT
XFF4834R

NP_640578.1 lcl|gpsA-XAC0222

1

341

S=1607 I=93 E=0

NAD(P)H-dependent glycerol-3-phosphate dehydrogenase

XFF4834R

YP_361938.1 lcl|gpsA-XCV0207

1

341

S=1603 I=93 E=0

NAD(P)H-dependent glycerol-3-phosphate dehydrogenase

XFF4834R

NP_635599.1 lcl|gpsA-XCC0204

1

341

S=1545 I=89 E=3.852e-180

NAD(P)H-dependent glycerol-3-phosphate dehydrogenase

XFF4834R

lcl|gpsA-XALc_3078

1

341

S=1343 I=78 E=1.22507e-155

probable glycerol-3-phosphate dehydrogenase [nad(p)+] protein

pubmed

1

334

S=748 I=47 E=6.46704e-82

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

Pubmed 8041620

 

prodomImg

pubmed

1

336

S=728 I=45 E=1.79061e-79

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

Pubmed 12486043

 

prodomImg

pubmed

7

334

S=635 I=46 E=2.79196e-68

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

Pubmed 7836292

 

prodomImg

pubmed

59

334

S=614 I=47 E=1.00415e-65

Glycerol-3-phosphate dehydrogenase EC=1.1.1.94 ; Cytoplasm NAD Oxidoreductase Phospholipid biosynthesis

Pubmed 16885444

 

prodomImg

pubmed

7

341

S=571 I=37 E=1.77786e-60

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

Pubmed 7592341,8760912

 

prodomImg

pubmed

7

334

S=560 I=36 E=3.50656e-59

Glycerol-3-phosphate dehydrogenase EC=1.1.1.94 ; Cytoplasm NAD Oxidoreductase Phospholipid biosynthesis

Pubmed 17636987

 

prodomImg

pubmed

7

334

S=546 I=41 E=1.62534e-57

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

Pubmed 19077236

 

prodomImg

pubmed

7

334

S=490 I=36 E=1.15009e-50

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

Pubmed 18281406

 

prodomImg

pubmed

7

334

S=486 I=38 E=3.33184e-50

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

Pubmed 18367281

 

prodomImg

pubmed

6

328

S=460 I=34 E=4.39304e-47

Glycerol-3-phosphate dehydrogenase [NAD+], glycosomal EC=1.1.1.8 ; Glycosome Oxidoreductase

Pubmed 8920004,10801498

 

prodomImg

sp_Pdown

sp|Q8PQU9|GPDA_XANAC

1

341

S=1607 I=93 E=0

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

sp_Pdown

sp|Q3BZ75|GPDA_XANC5

1

341

S=1603 I=93 E=0

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

sp_Pdown

sp|Q5GV21|GPDA_XANOR

1

341

S=1569 I=91 E=0

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

sp_Pdown

sp|Q2NYA5|GPDA_XANOM

1

341

S=1569 I=91 E=0

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

sp_Pdown

sp|Q8PDY0|GPDA_XANCP

1

341

S=1545 I=89 E=1.00444e-178

Glycerol-3-phosphate dehydrogenase [NAD(P)+] EC=1.1.1.94 ; Cytoplasm Oxidoreductase Phospholipid biosynthesis

PD001278

191

329

S=294 I=46 E=4.12813e-28

PD102920

95

192

S=176 I=42 E=7.71065e-14

PD688331

10

50

S=134 I=63 E=9.06194e-09

PD352232

46

93

S=120 I=53 E=4.6636e-07

PDA0W356

193

292

S=115 I=33 E=1.83317e-06

PDA8E236

8

87

S=114 I=39 E=2.69035e-06

PDA8E1X8

50

92

S=112 I=51 E=4.0178e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1ztTKUkL)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

193 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

1 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr01930.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr01930.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr01930.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr01930.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
glpK XFF4834R_chr03420
XFF4834R_chr03410
XFF4834R_chr03410
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr03430
XFF4834R_chr03430
ID glpK
AC XFF4834R_chr03420
LT XFF4834R_chr03420
OR XFF4834R_chr from 392606 to 394105 on strand -
DE probable glycerol kinase
IP Glycerol kinase; Carbohydrate kinase, FGGY, conserved site
CL 1.1.1.23 Galactose degradation GO:0019388
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Biological Process: glycerol-3-phosphate metabolic process (GO:0006072)
Molecular Function: glycerol kinase activity (GO:0004370)
alcohol group as acceptor (GO:0016773)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: validated by jacques (20110712)
MW 54904.9 Da
SQ 499 aa
 
........10........20........30........40........50
| | | | |
MEKQYVLAIDQGTTSSRAMLFDRRGKVAGVAQREFGQIFPQPGWVEHNPR
EIMTSVYTTITELLNNAQIDARAIAGIGITNQRETAVVWDKATGQPIYNA
IVWQSRQTKDICTQLKEAGHEQMVRDKTGLLIDAYFSGTKVKWILDHVEG
ARERAQKGELAFGTIDSWLIWNLTGGKVHVTDYTNASRTMMFNIHTLEWD
AELLAMLDVPAQMLPEVRSSSEVYGMTQTQYFYGEQVPIAGIAGDQQAAL
FGQACFEPGMAKNTYGTGCFMLMNTGDKAVASKAGLLTTIAWGIDGKVEY
ALEGAIFVAGSVVQWLRDGLRMLGKASDSQAYAERAGDNDGVYIVPAFVG
LGAPYWRSDIRGAVFGLTRGTTKEHFVRAAVESMAYQTRDVLTAMRSDSG
IELKELRADGGAIANDFMAQFQSDILNVPVLRPEVAETTALGAAYLAGLA
TGFWSSREEIAKQWAVDRRFEPAMADDKREALYAGWQQAVEATMGFRIS
XFF4834R

XFF4834R_chr27370 lcl|xylB-XFF4834R_chr27370

132

433

S=126 I=24 E=1.58061e-08

xylulokinase

XFF4834R

XFF4834R_chr41180 lcl|XFF4834R_chr_4781896_4783542_r1_XFF4834R-XFF4834R_chr41180

6

430

S=103 I=25 E=1.04658e-05

XFF4834R

XFF4834R_chr27370 lcl|xylB-XFF4834R_chr27370

132

433

S=126 I=24 E=1.58061e-08

xylulokinase

XFF4834R

XFF4834R_chr41180 lcl|XFF4834R_chr_4781896_4783542_r1_XFF4834R-XFF4834R_chr41180

6

430

S=103 I=25 E=1.04658e-05

XFF4834R

NP_640714.1 lcl|glpK-XAC0358

1

499

S=2539 I=96 E=0

glycerol kinase

XFF4834R

YP_362103.1 lcl|glpK-XCV0372

1

499

S=2528 I=95 E=0

glycerol kinase

XFF4834R

NP_635753.1 lcl|glpK-XCC0358

1

499

S=2482 I=93 E=0

glycerol kinase

XFF4834R

lcl|glpK-XALc_0443

1

498

S=2246 I=83 E=0

probable glycerol kinase protein

XFF4834R

NP_637124.1 lcl|XCC1757

67

433

S=133 I=23 E=8.24547e-09

D-xylulokinase

XFF4834R

YP_363538.1 lcl|XCV1807

132

433

S=124 I=25 E=1.11784e-07

putative xylulose kinase

XFF4834R

NP_642103.1 lcl|XAC1775-XAC1775

132

433

S=123 I=24 E=1.27402e-07

D-xylulokinase

pubmed

3

497

S=1828 I=69 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Transferase

Pubmed 9972264

 

prodomImg

pubmed

3

497

S=1818 I=68 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Transferase

Pubmed 9540790

 

prodomImg

pubmed

5

497

S=1811 I=65 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Phosphoprotein Transferase

Pubmed 2127799,9579061

 

prodomImg

pubmed

1

497

S=1792 I=64 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Transferase

Pubmed 15590099

 

prodomImg

pubmed

2

497

S=1616 I=60 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Phosphoprotein Transferase

Pubmed 9162046

 

prodomImg

pubmed

2

496

S=1613 I=59 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Metal-binding Nucleotide-binding Transferase Zinc

Pubmed 2826434,1372899

 

prodomImg

pubmed

2

496

S=1605 I=59 E=0

GlpK ; ATP-binding Glycerol metabolism Kinase Nucleotide-binding Plasmid Transferase

Pubmed 12620823

 

prodomImg

pubmed

2

497

S=1593 I=57 E=0

Glycerol kinase ; ATP-binding metabolism Nucleotide-binding Transferase

Pubmed 15383715

 

prodomImg

pubmed

3

496

S=1587 I=60 E=0

Glycerol kinase 1 EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Transferase

Pubmed 9141691

 

prodomImg

pubmed

2

498

S=1586 I=59 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Phosphoprotein Transferase

Pubmed 9162046,14717590

 

prodomImg

sp_Pdown

sp|Q8PQG7|GLPK_XANAC

1

499

S=2540 I=96 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Transferase

sp_Pdown

sp|Q3BYR0|GLPK_XANC5

1

499

S=2528 I=95 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Transferase

sp_Pdown

sp|Q8PDI0|GLPK_XANCP

1

499

S=2482 I=93 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Transferase

sp_Pdown

sp|B0RMN0|GLPK_XANCB

1

499

S=2482 I=93 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Transferase

sp_Pdown

sp|Q4UZR8|GLPK_XANC8

1

499

S=2478 I=93 E=0

Glycerol kinase EC=2.7.1.30 ; ATP-binding metabolism Nucleotide-binding Transferase

PD130304

262

498

S=425 I=43 E=6.9253e-44

PD130304

8

245

S=403 I=44 E=2.96524e-41

PD557882

250

314

S=168 I=53 E=8.53948e-13

PD242769

77

381

S=159 I=27 E=1.17806e-11

PD477597

246

322

S=157 I=46 E=1.75933e-11

PD800087

453

496

S=146 I=55 E=3.78615e-10

PD879263

5

90

S=137 I=33 E=5.79928e-09

PDA92830

3

193

S=133 I=20 E=1.59444e-08

PDA1I650

232

260

S=129 I=76 E=4.42211e-08

PD744076

194

259

S=127 I=45 E=8.9606e-08

PD001187

2

56

S=123 I=45 E=2.78344e-07

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one 1n4uXX3u)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

99 hits
swiss-prot

Swiss-Prot ncbi-blastp

0 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr03420.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr03420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr03420.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr03420.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
dgoA XFF4834R_chr27460
XFF4834R_chr_2898
XFF4834R_chr_2898
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27470
XFF4834R_chr27470
ID dgoA
AC XFF4834R_chr27460
LT XFF4834R_chr27460
OR XFF4834R_chr from 3177468 to 3178100 on strand +
DE putative 2-dehydro-3-deoxy-6-phosphogalactonate aldolase
IP KDPG/KHG aldolase
CL 1.1.1.23 Galactose degradation GO:0019388
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110110)
MW 21831.6 Da
SQ 210 aa
 
........10........20........30........40........50
| | | | |
MTSDTTASPFVLPLVAILRGITPEETLDHVGALIDAGFDAIEIPLNSPRW
EQSIALAQQTFGARAWIGAGTVLRNEDVDTLAGIGARFIVTPNTRPSLIR
HAVSCGLTVVAGFATASEAFDAIDAGATILKLFPAATYGAAHVRALRSVL
PTHIPVYVVGGVSPQTLAGFIAQGAAGAGIGGELYRPGQSLETTQTHARA
FVQAYQELQG
XFF4834R

XFF4834R_chr21720 lcl|eda-XFF4834R_chr21720

25

163

S=126 I=31 E=4.53009e-09

multifunctional 2-keto-3-deoxygluconate 6-phosphate aldolase and 2-keto-4-hydroxyglutarate aldolase and oxaloacetate decarboxylase

XFF4834R

NP_642094.1 lcl|dgoA-XAC1766

1

210

S=968 I=91 E=1.86023e-110

2-dehydro-3-deoxy-6-phosphogalactonate aldolase

XFF4834R

YP_363528.1 lcl|dgoA-XCV1797

1

210

S=945 I=89 E=1.04368e-107

2-dehydro-3-deoxy-6-phosphogalactonate aldolase

XFF4834R

NP_637114.1 lcl|dgoA-XCC1747

1

210

S=898 I=84 E=5.03632e-102

2-dehydro-3-deoxy-6-phosphogalactonate aldolase

XFF4834R

lcl|dgoA-XALc_1190

8

207

S=600 I=64 E=6.98721e-66

probable 2-dehydro-3-deoxy-6-phosphogalactonate aldolase protein

XFF4834R

lcl|alkH-XALc_1834

24

166

S=145 I=33 E=8.51881e-11

putativeketo-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase protein

XFF4834R

NP_637501.1 lcl|eda-XCC2140

25

163

S=132 I=31 E=3.9143e-09

keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase

XFF4834R

NP_642388.1 lcl|eda-XAC2067

32

163

S=127 I=32 E=1.63547e-08

keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase

XFF4834R

YP_363964.1 lcl|alkH-XCV2233

32

163

S=126 I=32 E=1.67881e-08

keto-hydroxyglutarate-aldolase/keto-deoxy- phosphogluconate aldolase

pubmed

12

207

S=547 I=55 E=7.41038e-58

2-dehydro-3-deoxy-6-phosphogalactonate aldolase EC=4.1.2.21 ; Lyase

Pubmed 7686882

 

prodomImg

pubmed

10

207

S=326 I=36 E=4.56419e-31

Putative 2-dehydro-3-deoxyphosphogalactonate aldolase

Pubmed 15640208

 

prodomImg

pubmed

14

209

S=281 I=38 E=1.15533e-25

2-keto-3-deoxy-6-phosphogluconate aldolase

Pubmed 15305924

 

prodomImg

pubmed

14

167

S=174 I=35 E=1.19378e-12

2-dehydro-3-deoxyphosphogluconate aldolase

Pubmed 10760168

 

prodomImg

pubmed

14

166

S=166 I=31 E=9.34413e-12

2-keto-3-deoxy-6-phosphogluconate aldolase

Pubmed 8031084,10368143

 

prodomImg

sp_Pdown

sp|Q6BF16|DGOA_ECOLI

12

207

S=547 I=55 E=5.13397e-58

2-dehydro-3-deoxy-6-phosphogalactonate aldolase EC=4.1.2.21 ; Lyase

sp_Pdown

sp|P50846|ALKH_BACSU

14

164

S=166 I=32 E=8.12084e-12

KHG/KDPG aldolase EC=4.1.3.16 EC=4.1.2.14 ; Cytoplasm Lyase Multifunctional enzyme Schiff base

sp_Pdown

sp|Q00384|ALKH_ZYMMO

32

166

S=140 I=29 E=1.14808e-08

KHG/KDPG aldolase EC=4.1.3.16 EC=4.1.2.14 ; Cytoplasm Lyase Multifunctional enzyme Schiff base

sp_Pdown

sp|O83578|ALKH_TREPA

11

139

S=136 I=31 E=3.38454e-08

Putative KHG/KDPG aldolase EC=4.1.3.16 EC=4.1.2.14 ; Cytoplasm Lyase Multifunctional enzyme Schiff base

sp_Pdown

sp|O68283|ALKD_PSEAE

11

167

S=124 I=33 E=1.01446e-06

2-dehydro-3-deoxy-phosphogluconate aldolase EC=4.1.2.14 ; Lyase Schiff base

Iprscan IPR013785 [G3DSA:3.20.20.70]

12

189

Aldolase-type TIM barrel

Iprscan IPR000887 [PF01081]

13

184

KDPG/KHG aldolase

Iprscan IPR000887 [PS00160]

126

139

KDPG/KHG aldolase

Iprscan [seg]

168

182

-

PD328925

85

139

S=126 I=44 E=8.26111e-08

PDA1U349

186

210

S=125 I=96 E=1.13071e-07

PD834346

15

82

S=116 I=41 E=1.32174e-06

Iprscan [SSF51569]

12

208

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RyGul4vA)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

17 hits
swiss-prot

Swiss-Prot ncbi-blastp

11 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

5 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr27460.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr27460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr27460.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr27460.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
dgoK XFF4834R_chr27490
XFF4834R_chr27480
XFF4834R_chr27480
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27500
XFF4834R_chr27500
ID dgoK
AC XFF4834R_chr27490
LT XFF4834R_chr27490
OR XFF4834R_chr from 3180147 to 3181025 on strand +
DE putative 2-oxo-3-deoxygalactonate kinase
IP 2-keto-3-deoxy-galactonokinase
CL 1.1.1.23 Galactose degradation GO:0019388
EC
GO InterPro


Curated
PM
AN other name 2-dehydro-3-deoxygalactonokinase
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 31084.1 Da
SQ 292 aa
 
........10........20........30........40........50
| | | | |
MIAIDWGTSSLRGYLLDADGKVRAQRRGSDGILTCQGRFDDVLAGLIDGW
DGPLLLSGMIGSRNGWVEQPYLPCPADTAALAQAMRCYDALLPGRALWFV
PGVSTGEQTGVPDVMRGEETQLVGLIAALGDGEHVACLPGTHSKWARIAN
GQLTGFATVMTGELYAVLRRHSILGKLMDDDHAELDAAAFVQGVDRSNDP
GGLSHHLFGTRTLGLFERLSSAALPSYLSGVLIGHELREHRGGHAIVHLV
GSPALAQRYALALQHLGVESRMHPEDLAAAGLFALARQRGLA
Show or not Domain decomposition
 
XFF4834R

NP_642091.1 lcl|dgoK-XAC1763

1

292

S=1354 I=97 E=5.23632e-157

2-oxo-3-deoxygalactonate kinase

XFF4834R

YP_363525.1 lcl|XCV1794

1

292

S=1329 I=95 E=4.957e-154

putative 2-oxo-3-deoxygalactonate kinase

XFF4834R

NP_637111.1 lcl|dgoK-XCC1744

1

292

S=1187 I=82 E=9.1555e-137

2-oxo-3-deoxygalactonate kinase

XFF4834R

lcl|dgoK-XALc_1187

1

290

S=910 I=62 E=3.20871e-103

probable 2-dehydro-3-deoxygalactonokinase protein

pubmed

1

264

S=332 I=37 E=1.32388e-31

2-keto-3-deoxy-galactonokinase

Pubmed 15305924

 

prodomImg

pubmed

2

268

S=332 I=32 E=1.48277e-31

Putative 2-keto-3-deoxy-galactonokinase

Pubmed 15640208

 

prodomImg

pubmed

2

286

S=307 I=32 E=1.6138e-28

2-dehydro-3-deoxygalactonokinase EC=2.7.1.58 ; ATP-binding Nucleotide-binding Transferase

Pubmed 7686882

 

prodomImg

pubmed

138

237

S=199 I=48 E=1.74181e-15

Putative 2-keto-3-deoxygalactokinase

Pubmed 18262744

 

prodomImg

sp_Pdown

sp|P31459|DGOK_ECOLI

2

286

S=307 I=32 E=1.099e-28

2-dehydro-3-deoxygalactonokinase EC=2.7.1.58 ; ATP-binding Nucleotide-binding Transferase

Iprscan IPR007729 [PF05035]

5

286

2-keto-3-deoxy-galactonokinase

PD127871

70

272

S=424 I=49 E=7.54961e-44

PDA9B9E3

230

292

S=212 I=87 E=3.06237e-18

PDA1G2V8

1

71

S=187 I=53 E=3.60507e-15

PDA2F0W3

72

106

S=149 I=80 E=1.47529e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one xvqLyRPe)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

4 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

1 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr27490.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr27490.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr27490.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBgo8gk0/XFF4834R_chr27490.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.