Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr41070XFF4834R_chr_4770540_4772012_f3_XFF4834R-XFF4834R_chr41070XFF4834R_chr41070putative mannitol dehydrogenase

XFF4834R_chr_4770540_4772012_f3_XFF4834R-XFF4834R_chr41070 XFF4834R_chr41070
XFF4834R_chr41060
XFF4834R_chr41060
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr41080
XFF4834R_chr41080
ID XFF4834R_chr_4770540_4772012_f3_XFF4834R-XFF4834R_chr41070
AC XFF4834R_chr41070
LT XFF4834R_chr41070
OR XFF4834R_chr from 4770540 to 4772012 on strand +
DE putative mannitol dehydrogenase
IP Mannitol dehydrogenase, core; Fatty oxidation complex, alpha subunit FadB
CL 1.1.1.21 Mannitol degradation GO:0019592
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: binding (GO:0005488)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: coenzyme binding (GO:0050662)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 52760.3 Da
SQ 490 aa
 
........10........20........30........40........50
| | | | |
MHAPRLSLDTLATLPPVVATPSYDLARTTIGIVHLGAGAFHRAHQAVYVD
DLLAEDPSWAISAVSLHRPQVRDALRPQEGLYTLALLDEHPQLRVIGAIG
EVLCAADEHAAVLARLADPAVRLVTLTITEKGYCLAGDTLDLSHPDIAHD
IAHPATPHSAIGYLVAGLRQRMHDGTAPFTALSCDNLTDNGTLLQRAVVR
LAAQVDPALAEWIAQHAAFPRSMVDSITPATDEALRARIHDQLGVHDAWP
IQRERYSQWVIEDRFCNGRPAFERAGVTLSEDIAGYARAKLRLLNAPHSA
LAYLGSLLNLETVADAMRHRELAAYLETLMRAEIAPTLQTMDGFDAQGYS
DAILARFRNPAIRHLLAQIAWDGSQKIPVRLLGTIGDALATDQPIQHLCL
AVAAWLHFVRRQAQHGVALADPMNDALSARGRNATGDADHDVAAFLTLEA
VFGSLPADARFCASLQAAYAALGTATPTEVTRALGSMGDA
XFF4834R

NP_644531.1 lcl|mtlD-XAC4232

1

489

S=2402 I=95 E=0

mannitol dehydrogenase

XFF4834R

YP_366069.1 lcl|mtlD-XCV4338

1

489

S=2262 I=90 E=0

mannitol dehydrogenase

XFF4834R

NP_639446.1 lcl|mtlD-XCC4107

1

486

S=1880 I=76 E=0

mannitol dehydrogenase

XFF4834R

lcl|XALc_0057

4

487

S=1668 I=69 E=0

putative mannitol dehydrogenase protein

pubmed

17

468

S=816 I=38 E=6.21149e-90

Mannitol 2-dehydrogenase EC=1.1.1.67 ; NAD NADP Oxidoreductase

Pubmed 18983992

 

prodomImg

pubmed

5

472

S=808 I=38 E=5.94156e-89

Mannitol 2-dehydrogenase EC=1.1.1.67 ; NAD Oxidoreductase

Pubmed 18024570

 

prodomImg

pubmed

5

472

S=802 I=38 E=2.82934e-88

Mannitol dehydrogenase EC=1.1.1.67 ; Oxidoreductase

Pubmed 9116029,9461423

 

prodomImg

pubmed

6

416

S=755 I=37 E=1.35345e-82

L-sorbose reductase

Pubmed 11790761

 

prodomImg

pubmed

14

472

S=733 I=38 E=6.66266e-80

Mannitol 2-dehydrogenase EC=1.1.1.67 ; Oxidoreductase

Pubmed 9256491

 

prodomImg

sp_Pdown

sp|P33029|YEIQ_ECOLI

8

472

S=852 I=42 E=1.83613e-94

Uncharacterized oxidoreductase yeiQ EC=1.-.-.- ; NAD

sp_Pdown

sp|P39160|UXUB_ECOLI

12

484

S=828 I=42 E=1.3736e-91

D-mannonate oxidoreductase EC=1.1.1.57 ; NAD

sp_Pdown

sp|A1CVQ6|M2DH_NEOFI

17

468

S=822 I=38 E=6.71436e-91

Mannitol 2-dehydrogenase EC=1.1.1.67 ; NAD Oxidoreductase

sp_Pdown

sp|Q4WQY4|M2DH_ASPFU

17

468

S=816 I=38 E=4.22627e-90

Mannitol 2-dehydrogenase EC=1.1.1.67 ; NAD NADP Oxidoreductase

sp_Pdown

sp|B0Y581|M2DH_ASPFC

17

468

S=816 I=38 E=4.22627e-90

Mannitol 2-dehydrogenase EC=1.1.1.67 ; NAD Oxidoreductase

Iprscan IPR000669 [PR00084]

32

42

Mannitol dehydrogenase, core

Iprscan IPR000669 [PR00084]

178

191

Mannitol dehydrogenase, core

Iprscan IPR000669 [PR00084]

217

230

Mannitol dehydrogenase, core

Iprscan IPR000669 [PR00084]

247

262

Mannitol dehydrogenase, core

Iprscan IPR016040 [G3DSA:3.40.50.720]

4

280

NAD(P)-binding domain

Iprscan IPR013328 [G3DSA:1.10.1040.10]

281

472

Dehydrogenase, multihelical

Iprscan IPR013118 [PF08125]

215

453

Mannitol dehydrogenase, C-terminal

Iprscan IPR013131 [PF01232]

31

187

Mannitol dehydrogenase, N-terminal

Iprscan [SignalP-NN(euk)]

1

19

-

PD008530

30

242

S=541 I=54 E=4.96523e-58

PD004131

290

472

S=343 I=43 E=5.84456e-34

PD691315

423

486

S=181 I=58 E=2.09057e-14

PDA1F8P0

243

286

S=145 I=55 E=6.03624e-10

PDA904K5

1

29

S=125 I=90 E=1.42858e-07

PDA2E479

294

427

S=113 I=28 E=4.43392e-06

PDA904N5

1

29

S=102 I=76 E=9.45914e-05

Iprscan IPR016040 [SSF51735]

4

281

NAD(P)-binding domain

Iprscan IPR008927 [SSF48179]

282

484

6-phosphogluconate dehydrogenase, C-terminal-like

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one ehwOeiTZ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

34 hits
swiss-prot

Swiss-Prot ncbi-blastp

163 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNKTQgM/XFF4834R_chr41070.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNKTQgM/XFF4834R_chr41070.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNKTQgM/XFF4834R_chr41070.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBNKTQgM/XFF4834R_chr41070.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.