Xanthomonas fuscans subsp. fuscans

2 hits

  1. XFF4834R_chr05720aceEXFF4834R_chr05720Probable pyruvate dehydrogenase E1 component
  2. XFF4834R_chr10120XFF4834R_chr10610953_1146939_f1_XFF4834R-XFF4834R_chr10120XFF4834R_chr10120Probable malate dehydrogenase

aceE XFF4834R_chr05720
XFF4834R_chr05710
XFF4834R_chr05710
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr05740
XFF4834R_chr05740
ID aceE
AC XFF4834R_chr05720
LT XFF4834R_chr05720
OR XFF4834R_chr from 649751 to 652438 on strand +
DE Probable pyruvate dehydrogenase E1 component
IP 2-oxo-acid dehydrogenase E1 component homodimeric type; Transketolase, N-terminal; Transketolase-like, C-terminal
CL 1.1.1.20 Glycol degradation GO:0042846
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: oxidation reduction (GO:0055114)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: oxidoreductase activity (GO:0016491)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100503)
MW 99547.1 Da
SQ 895 aa
 
........10........20........30........40........50
| | | | |
MNWLNEVLHNDPNPLETQEWLESIKAVIDVEGPERAHQLLEGMVEQTRRA
GAYLPFSPTTEYVNTISPANEAKHPGDSALEWKIRSIIRWNAMATVVRAN
RKPGDLGGHIASFASSATLYDVGFNHFWRAPSDNHPGDLLFIQGHSAPGI
YARAFLEGRISQSQLDNFRMEVDGQGISSYPHPWLMPEFWQTPTVSMGLG
PLAAIYQAQFMRYLENRGLIEKSDRKVWCFIGDGESDEPETLGAIALAGR
EGLDNLIFVVNCNLQRLDGPVRGNGKIIQELEGVFRGGGWNVIKLLWGGY
WDALLAKDSDGVLRKLMMETVDGEYQNCKAFGGAYTRANFFGKYPETAAM
VAGLSDDDIWRLNRGGHDPHKVYAAYHQAVNTTGMPTVILAKTVKGYGMG
SAGEALNPTHQTKKLDDAAVKHFRDRFNIPVTDAQLEDGQVPFYHPGEDS
PEVQYLKERRSVLGGFLPSRRPKASKSFVAPTLDKFERLLKDSGERSYST
TMSFVQSLNIALRDKELGPRIVPIVADEARTFGMEGMFRQIGIYAPFGQK
YKPVDADQLMYYREDQTGQVLQQGISEPGAIASWMAAGTSYSVSDVPMLP
FYIYYSMFGFQRVGDIAWQAADMRTRGFLLGGTAGRTTLNGEGLQHEDGF
SQVIAGSIPNVRSYDPTFGFEVTVIMQHGMKAMMEDQVDEYYYITLMNEN
YAHPGMPEGAAEGIIKGMYLLKDAGKPKKGELRVQLLGSGTILREAIAAA
ELLDKDFGVTADIWSCPSLNEVRRDGYAVERWNRLHPEAEQRKPYVTQLL
EGRQGPAVAATDYVRAFADQIRAFVPMTYTVLGTDGFGRSDTRANLRRFF
EVDRYYIAHAAIAALAKDGKMTGKDVARAIKQYKIDPEKANPVGV
X.species

NP_640929.1 lcl|aceE-XAC0576

1

895

S=4672 I=97 E=0

pyruvate dehydrogenase subunit E1

X.species

NP_638971.1 lcl|aceE-XCC3625

1

895

S=4584 I=95 E=0

pyruvate dehydrogenase subunit E1

X.species

YP_362342.1 lcl|aceE-XCV0611

1

895

S=4552 I=94 E=0

pyruvate dehydrogenase subunit E1

X.species

lcl|aceE-XALc_0337

1

895

S=4293 I=88 E=0

probable pyruvate dehydrogenase (acetyl-transferring) protein

pubmed

10

893

S=2972 I=62 E=0

Pyruvate dehydrogenase E1 component EC=1.2.4.1 ; Glycolysis Oxidoreductase Thiamine pyrophosphate

Pubmed 9171401

 

prodomImg

pubmed

4

892

S=2940 I=60 E=0

Dihydrolipoamide acyltransferase

Pubmed 17526788

 

prodomImg

pubmed

10

895

S=2884 I=60 E=0

Pyruvate dehydrogenase E1 component EC=1.2.4.1 ; Glycolysis Oxidoreductase Thiamine pyrophosphate

Pubmed 8021225

 

prodomImg

pubmed

4

892

S=2634 I=55 E=0

Pyruvate dehydrogenase E1 component EC=1.2.4.1 ; Acetylation Glycolysis Magnesium Metal-binding Oxidoreductase Thiamine pyrophosphate

Pubmed 6343085,8202364

 

prodomImg

pubmed

11

892

S=2435 I=53 E=0

Pyruvate dehydrogenase (E1) EC=1.2.4.1 ; Oxidoreductase

Pubmed 8647112

 

prodomImg

pubmed

11

883

S=2271 I=51 E=0

Alpha-ketobutyrate dehydrogenase E1

Pubmed 8586629,9190812

 

prodomImg

pubmed

10

886

S=2156 I=49 E=0

Pyruvate dehydrogenase

Pubmed 17600063

 

prodomImg

pubmed

11

885

S=2065 I=48 E=0

Pyruvate dehydrogenase component

Pubmed 9858775

 

prodomImg

pubmed

10

438

S=1539 I=65 E=2.69808e-177

Dehydrogenase (E1) component of pyruvate dehydrogenase complex

Pubmed 16796688

 

prodomImg

pubmed

145

287

S=573 I=71 E=2.86271e-60

Putative uncharacterized protein

Pubmed 17124322

 

prodomImg

sp

10

893

S=2972 I=62 E=0

Pyruvate dehydrogenase E1 component EC=1.2.4.1 ; Glycolysis Oxidoreductase Thiamine pyrophosphate

 

prodomImg

sp

10

895

S=2884 I=60 E=0

Pyruvate dehydrogenase E1 component EC=1.2.4.1 ; Glycolysis Oxidoreductase Thiamine pyrophosphate

 

prodomImg

sp

4

892

S=2634 I=55 E=0

Pyruvate dehydrogenase E1 component EC=1.2.4.1 ; Acetylation Glycolysis Magnesium Metal-binding Oxidoreductase Thiamine pyrophosphate

 

prodomImg

sp

4

892

S=2634 I=55 E=0

Pyruvate dehydrogenase E1 component EC=1.2.4.1 ; Acetylation Glycolysis Magnesium Metal-binding Oxidoreductase Thiamine pyrophosphate

 

prodomImg

sp

4

893

S=2599 I=55 E=0

Pyruvate dehydrogenase E1 component EC=1.2.4.1 ; Glycolysis Oxidoreductase Thiamine pyrophosphate

 

prodomImg

PD008826

758

856

S=352 I=67 E=5.71466e-35

PD605160

332

853

S=206 I=23 E=2.87674e-17

PD008560

11

66

S=161 I=55 E=7.47486e-12

PD308336

71

295

S=159 I=29 E=1.22867e-11

PD308336

410

472

S=134 I=43 E=1.30272e-08

PDA1D520

136

307

S=139 I=26 E=2.93332e-09

PDA1Y9B6

473

498

S=132 I=100 E=2.25632e-08

PDA1K720

867

895

S=129 I=86 E=5.443e-08

PDA652N2

473

498

S=122 I=88 E=3.77088e-07

PDA408D7

759

802

S=115 I=45 E=2.80116e-06

PD933168

500

534

S=112 I=66 E=6.30207e-06

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one HHbpmaUo)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

41 hits
swiss-prot

Swiss-Prot ncbi-blastp

21 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSmFKzO/XFF4834R_chr05720.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSmFKzO/XFF4834R_chr05720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSmFKzO/XFF4834R_chr05720.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSmFKzO/XFF4834R_chr05720.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
XFF4834R_chr10610953_1146939_f1_XFF4834R-XFF4834R_chr10120 XFF4834R_chr10120
XFF4834R_chr10110
XFF4834R_chr10110
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr10130
XFF4834R_chr10130
ID XFF4834R_chr10610953_1146939_f1_XFF4834R-XFF4834R_chr10120
AC XFF4834R_chr10120
LT XFF4834R_chr10120
OR XFF4834R_chr from 1145953 to 1146939 on strand +
DE Probable malate dehydrogenase
IP Lactate/malate dehydrogenase
CL 1.1.1.20 Glycol degradation GO:0042846
EC
GO InterPro
Biological Process: cellular carbohydrate metabolic process (GO:0044262)
Biological Process: malate metabolic process (GO:0006108)
Biological Process: glycolysis (GO:0006096)
Biological Process: oxidation reduction (GO:0055114)
Biological Process: metabolic process (GO:0008152)
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: malate dehydrogenase activity (GO:0016615)
Molecular Function: oxidoreductase activity (GO:0016491)
Molecular Function: binding (GO:0005488)
NAD or NADP as acceptor (GO:0016616)

Curated
PM
AN
CC COG: [C] Energy production and conversion;
CC MODEL: XFF4834R
CC STATUS: curated by fguerin (20100817)
MW 34993.9 Da
SQ 328 aa
 
........10........20........30........40........50
| | | | |
MKAPVRVAVTGAAGQIGYALLFRIASGEMLGKDQPVILQLLELPIEKAQA
ALKGVMMELEDCAFPLLAGMVGTDDAEVAFKDVDVALLVGSRPRGPGMER
KDLLLANAEIFTAQGAALNKVAKRDVKVLVVGNPANTNAYIAMKSAPDLD
PKNFTAMLRLDHNRALSQLSAKLGKPVAGIEKLVVWGNHSPTMYPDYRFA
TADGASIGDTINDQEWNASTFIPTVGKRGAAIIEARGLSSAASAANAAID
HIRDWVLGTNGKWVTMGVPSDGSYGIPEGVMFGFPVTTENGKYTIVKDLP
IDDFSQKYIDKTLAELEEERSGVAHLLD
X.species

YP_362765.1 lcl|mdh-XCV1034

1

327

S=1639 I=96 E=0

malate dehydrogenase

X.species

NP_641353.1 lcl|mdh-XAC1006

1

327

S=1637 I=96 E=0

malate dehydrogenase

X.species

NP_636314.1 lcl|mdh-XCC0928

1

327

S=1580 I=91 E=0

malate dehydrogenase

X.species

lcl|mdh-XALc_0546

1

327

S=1553 I=90 E=0

probable malate dehydrogenase protein

pubmed

2

327

S=1285 I=74 E=5.26751e-147

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 10206992

 

prodomImg

pubmed

6

327

S=1284 I=77 E=6.5504e-147

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 9190829

 

prodomImg

pubmed

2

327

S=1268 I=75 E=5.68799e-145

NAD-dependent malate dehydrogenase ; Tricarboxylic acid cycle

Pubmed 12113928,16133321

 

prodomImg

pubmed

2

327

S=1223 I=70 E=1.97068e-139

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 8900056

 

prodomImg

pubmed

2

326

S=1041 I=63 E=2.00347e-117

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

Pubmed 19370165

 

prodomImg

sp

1

327

S=1639 I=96 E=0

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

 

prodomImg

sp

1

327

S=1637 I=96 E=0

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

 

prodomImg

sp

1

327

S=1580 I=91 E=0

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

 

prodomImg

sp

1

327

S=1580 I=91 E=0

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

 

prodomImg

sp

1

327

S=1576 I=91 E=0

Malate dehydrogenase EC=1.1.1.37 ; NAD Oxidoreductase Tricarboxylic acid cycle

 

prodomImg

Iprscan IPR016040 [G3DSA:3.40.50.720]

1

156

NAD(P)-binding domain

Iprscan IPR015955 [G3DSA:3.90.110.10]

157

326

Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal

Iprscan [MF_01517]

1

327

-

Iprscan IPR001557 [PIRSF000102]

4

322

L-lactate/malate dehydrogenase

Iprscan IPR010945 [PTHR23382]

99

327

Malate dehydrogenase, NAD/NADP

Iprscan IPR001236 [PF00056]

5

155

Lactate/malate dehydrogenase

Iprscan IPR001236 [PF02866]

159

321

Lactate/malate dehydrogenase

Iprscan IPR010945 [TIGR01759]

2

323

Malate dehydrogenase, NAD/NADP

Iprscan [seg]

239

248

-

Iprscan [SignalP-NN(euk)]

1

27

-

PD003052

157

320

S=482 I=57 E=7.0138e-51

PD673146

45

156

S=421 I=76 E=1.58251e-43

PDA8N3W2

263

321

S=197 I=56 E=2.43474e-16

PDA0F041

6

42

S=166 I=86 E=1.19755e-12

Iprscan IPR015955 [SSF56327]

158

328

Lactate dehydrogenase/glycoside hydrolase, family 4, C-terminal

Iprscan IPR016040 [SSF51735]

2

157

NAD(P)-binding domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one j5I5vldJ)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

165 hits
swiss-prot

Swiss-Prot ncbi-blastp

429 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

12 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSmFKzO/XFF4834R_chr10120.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSmFKzO/XFF4834R_chr10120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSmFKzO/XFF4834R_chr10120.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBSmFKzO/XFF4834R_chr10120.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.