Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr01110kdgKXFF4834R_chr01110probable 2-keto-3-deoxygluconate kinase

kdgK XFF4834R_chr01110
XFF4834R_chr01100
XFF4834R_chr01100
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr01120
XFF4834R_chr01120
ID kdgK
AC XFF4834R_chr01110
LT XFF4834R_chr01110
OR XFF4834R_chr from 138960 to 139982 on strand +
DE probable 2-keto-3-deoxygluconate kinase
IP Carbohydrate/purine kinase
CL 1.1.1.2 2,5-ketogluconate metabolism GO:0019522
EC
GO InterPro


Curated
PM
AN pectin degradation
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by darrasse (20120309)
MW 36361.1 Da
SQ 340 aa
 
........10........20........30........40........50
| | | | |
MSRARILCFGELLLRLGAPGHALLLQQPRLDVHCGGAEANVGVSLAHFGH
AVAMVSTVADNPLGAAVLGELRRHDVDTRHVRRVDGRMGLYFLTTGAIHR
PSEVIYDRADSAFALAPADAYDWPRLLEGVQWLHLSGVSPALGAEVAQAT
LAAARAARAAGVKVSFDGNYRPKLWQRWQGDARGILHQLFACADVVFADY
RDIGVVLGGEFAQDTLEARVEAAAQQAFAAFPQLQLMACTQRVAHHVDHH
SLGAMLVPRDGAVARAPSEELTPIIDRIGGGDAFAAGVLHGLIEGWSLED
TVRFGLAAGCLKHSIPGDFNPLSVADVQACVGDARFDVRR
Show or not Domain decomposition
 
XFF4834R

NP_640499.1 lcl|kdgK-XAC0143

1

340

S=1304 I=78 E=7.45855e-151

2-keto-3-deoxygluconate kinase

XFF4834R

YP_361853.1 lcl|kdgK-XCV0122

1

340

S=1296 I=77 E=5.44475e-150

2-keto-3-deoxygluconate kinase

XFF4834R

NP_635513.1 lcl|kdgK-XCC0118

1

340

S=1254 I=75 E=6.92128e-145

2-keto-3-deoxygluconate kinase

XFF4834R

lcl|XALc_0022

1

340

S=919 I=56 E=3.21551e-104

putative 2-dehydro-3-deoxygluconokinase protein

Iprscan [G3DSA:3.40.1190.20]

5

334

-

Iprscan [PTHR10584:SF32]

9

340

-

Iprscan [PTHR10584]

9

340

-

Iprscan IPR011611 [PF00294]

4

311

Carbohydrate/purine kinase

Iprscan [seg]

72

87

-

Iprscan [seg]

107

122

-

Iprscan [seg]

141

162

-

Iprscan [seg]

222

238

-

Iprscan [SignalP-NN(euk)]

1

22

-

Iprscan [SSF53613]

1

332

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one KIkBitLV)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

5 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

10 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQC8yNw/XFF4834R_chr01110.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQC8yNw/XFF4834R_chr01110.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQC8yNw/XFF4834R_chr01110.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBQC8yNw/XFF4834R_chr01110.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.