Xanthomonas fuscans subsp. fuscans

4 hits

  1. XFF4834R_chr27360xylA1XFF4834R_chr27360probable D-xylose isomerase
  2. XFF4834R_chr27370xylB1XFF4834R_chr27370putative D-xylulokinase
  3. XFF4834R_chr41000xylA2XFF4834R_chr41000probable D-xylose isomerase
  4. XFF4834R_chr41180xylB2XFF4834R_chr41180putative D-xylulose kinase

xylA1 XFF4834R_chr27360
XFF4834R_chr27350
XFF4834R_chr27350
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27370
XFF4834R_chr27370
ID xylA1
AC XFF4834R_chr27360
LT XFF4834R_chr27360
OR XFF4834R_chr from 3155340 to 3156677 on strand -
DE probable D-xylose isomerase
IP Xylose isomerase; Xylose isomerase, bacterial type
CL 1.1.1.19 Xylose catabolism GO:0042843
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: xylose isomerase activity (GO:0009045)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 48863.1 Da
SQ 445 aa
 
........10........20........30........40........50
| | | | |
MSNTVYIGAKEYFPGIGKIGFEGRDSDNPLAFKVYDANKTIGDKTMAEHL
RFAVAYWHSFCGNGADPFGPGTRAYPWDVGDTALNRAEAKADAAFEFFTK
LGVPYYCFHDIDLSPDADDIGQYESNLKHMVGIAKQRQADTGIKLLWGTA
NLFSHPRYMNGASTNPDFNVVARAAVQVKAAIEATVELGGENYVFWGGRE
GYACLHNTQMKREQDNMARFLTLARDYGRSLGFKGNFLIEPKPMEPMKHQ
YDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKV
RRESSDPQDLFLAHIGGMDAFARGLEVANALLTASPLEQWRAERYASFDS
GAGADFAAGKTTLADLAKHAAGNVPRQISGRQEAYENLINQYLTR
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr41000 lcl|xylA-XFF4834R_chr41000

1

445

S=2138 I=90 E=0

D-xylose isomerase

XFF4834R

NP_644524.2 lcl|xylA-XAC4225

1

445

S=2122 I=89 E=0

xylose isomerase

XFF4834R

NP_642104.2 lcl|xylA-XAC1776

1

445

S=2113 I=89 E=0

xylose isomerase

XFF4834R

YP_366061.1 lcl|xylA-XCV4330

1

445

S=2106 I=88 E=0

xylose isomerase

XFF4834R

YP_363539.1 lcl|XCV1808

1

445

S=2106 I=88 E=0

xylose isomerase

XFF4834R

NP_639439.1 lcl|xylA-XCC4100

1

445

S=2029 I=85 E=0

xylose isomerase

XFF4834R

NP_637125.1 lcl|xylA-XCC1758

1

445

S=2014 I=84 E=0

xylose isomerase

XFF4834R

lcl|xylA1-XALc_1196

1

445

S=1922 I=81 E=0

probable xylose isomerase protein

XFF4834R

lcl|xylA2-XALc_0064

1

445

S=1922 I=81 E=0

probable xylose isomerase protein

pubmed

9

442

S=1297 I=55 E=2.79471e-148

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Metal-binding Pentose shunt

Pubmed 12811467

 

prodomImg

pubmed

10

442

S=1286 I=55 E=6.01431e-147

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Metal-binding Pentose shunt

Pubmed 19050860

 

prodomImg

pubmed

12

443

S=1091 I=50 E=2.299e-123

Xylose kinase

Pubmed 8031084,10368143

 

prodomImg

pubmed

10

443

S=1080 I=47 E=5.58985e-122

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

Pubmed 1324398

 

prodomImg

pubmed

12

443

S=1080 I=47 E=6.20638e-122

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

Pubmed 12066186

 

prodomImg

sp_Pdown

sp|Q8PEW5|XYLA2_XANAC

1

445

S=2122 I=89 E=0

Xylose isomerase 2 EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

sp_Pdown

sp|Q3BMF2|XYLA_XANC5

1

445

S=2106 I=88 E=0

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

sp_Pdown

sp|Q2NXR2|XYLA_XANOM

1

445

S=2098 I=88 E=0

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

sp_Pdown

sp|Q5GUF2|XYLA2_XANOR

1

445

S=2098 I=88 E=0

Xylose isomerase 2 EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

sp_Pdown

sp|Q5GYQ7|XYLA1_XANOR

1

445

S=2098 I=88 E=0

Xylose isomerase 1 EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

Iprscan IPR001998 [PR00688]

100

122

Xylose isomerase

Iprscan IPR001998 [PR00688]

141

161

Xylose isomerase

Iprscan IPR001998 [PR00688]

164

183

Xylose isomerase

Iprscan IPR001998 [PR00688]

188

209

Xylose isomerase

Iprscan IPR001998 [PR00688]

215

234

Xylose isomerase

Iprscan IPR001998 [PR00688]

237

261

Xylose isomerase

Iprscan IPR001998 [PR00688]

279

306

Xylose isomerase

Iprscan IPR001998 [PR00688]

308

319

Xylose isomerase

Iprscan IPR001998 [PR00688]

341

352

Xylose isomerase

Iprscan IPR013022 [G3DSA:3.20.20.150]

10

443

Xylose isomerase-like, TIM barrel domain

Iprscan IPR001998 [MF_00455]

19

443

Xylose isomerase

Iprscan IPR012307 [PF01261]

91

317

Xylose isomerase, TIM barrel domain

Iprscan IPR013452 [TIGR02630]

12

443

Xylose isomerase, bacterial type

Iprscan IPR001998 [PS51415]

43

443

Xylose isomerase

Iprscan [seg]

87

98

-

Iprscan [seg]

170

184

-

Iprscan [seg]

396

409

-

PD003353

18

443

S=1146 I=53 E=2.48454e-131

Iprscan IPR013022 [SSF51658]

10

443

Xylose isomerase-like, TIM barrel domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one X21moswx)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

40 hits
swiss-prot

Swiss-Prot ncbi-blastp

195 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr27360.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr27360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr27360.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr27360.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
xylB1 XFF4834R_chr27370
XFF4834R_chr27360
XFF4834R_chr27360
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27380
XFF4834R_chr27380
ID xylB1
AC XFF4834R_chr27370
LT XFF4834R_chr27370
OR XFF4834R_chr from 3156725 to 3158218 on strand -
DE putative D-xylulokinase
IP
CL 1.1.1.19 Xylose catabolism GO:0042843
EC
GO InterPro


Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20110110)
MW 53027.5 Da
SQ 497 aa
 
........10........20........30........40........50
| | | | |
MSLYVGLDVGTQSVKLVAYDPQDRAVVATIAAPMELISRDDGTREQQAQW
WIDGIVHCFAQLDGEQRARVRGISVSGQQHGFVPVAADGSVTAPVKLWCD
TSTALECDEIMDAVGGAAGSVAAAGNPIMAGYTASKLPWTRKHRPEAYAA
MTTVMLPHDYINFWLTGERFAEVGDASGTGWLDVRTRQWSERMLSAVDAQ
RDLRDALPPLVDTGAVYALSDAAAQALHLPAGVRVTTGSGDNMMAAIGTG
NVVPGRLTMSLGTSGTLFAYADHPVVDDDARWAAFCSSSGGWLPLICTMN
CTVATEAVMRMFSITRDQTEAMIADTAPGADGLVLLPFFNGERTPDLPAA
RGCLFGMDLHNTTAAHFYRAAMEGATYSLRNGFDAFVAAGLQFDTILLTG
GGSKSAQWRQMVADIFNLQVVVPTQPEGAAFGAALQALWACERADGGDAA
LADVVLEHLQVDDALAAQPNPQRVAQYQQHYQTFLKHLHVVSPLYAG
XFF4834R

XFF4834R_chr41180 lcl|XFF4834R_chr_4781896_4783542_r1_XFF4834R-XFF4834R_chr41180

3

415

S=176 I=26 E=1.22786e-14

XFF4834R

XFF4834R_chr03420 lcl|glpK-XFF4834R_chr03420

128

427

S=127 I=24 E=1.17985e-08

glycerol kinase

XFF4834R

YP_363538.1 lcl|XCV1807

1

497

S=2377 I=91 E=0

putative xylulose kinase

XFF4834R

NP_642103.1 lcl|XAC1775-XAC1775

1

497

S=2365 I=91 E=0

D-xylulokinase

XFF4834R

NP_637124.1 lcl|XCC1757

1

497

S=2222 I=87 E=0

D-xylulokinase

XFF4834R

lcl|xylB-XALc_1195

1

497

S=1794 I=69 E=0

probable xylulose kinase protein

XFF4834R

YP_366081.1 lcl|xylB4-XCV4350

3

415

S=184 I=26 E=5.1057e-15

xylulose kinase

XFF4834R

NP_644543.2 lcl|xylB-XAC4244

3

415

S=173 I=26 E=1.03371e-13

xylulose kinase

XFF4834R

lcl|glpK-XALc_0443

128

427

S=132 I=24 E=1.07527e-08

probable glycerol kinase protein

XFF4834R

NP_640714.1 lcl|glpK-XAC0358

128

427

S=131 I=25 E=1.55079e-08

glycerol kinase

XFF4834R

NP_635753.1 lcl|glpK-XCC0358

60

427

S=127 I=23 E=4.81723e-08

glycerol kinase

XFF4834R

YP_362103.1 lcl|glpK-XCV0372

128

427

S=126 I=24 E=5.93846e-08

glycerol kinase

pubmed

1

496

S=1080 I=41 E=7.08586e-122

D-xylulokinase EC=2.7.1.17 ; Transferase

Pubmed 12811467

 

prodomImg

pubmed

2

427

S=977 I=47 E=1.6923e-109

Xylulose kinase ; Transferase

Pubmed 9116029,9461423

 

prodomImg

pubmed

4

420

S=593 I=33 E=5.51957e-63

Xylulose kinase ; Transferase

Pubmed 1368665,9495747

 

prodomImg

pubmed

3

427

S=545 I=36 E=4.1549e-57

Xylulose kinase EC=2.7.1.17 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

Pubmed 1657868

 

prodomImg

pubmed

3

421

S=541 I=32 E=1.396e-56

Xylulose kinase ; Transferase

Pubmed 16151815

 

prodomImg

sp_Pdown

sp|P44401|XYLB_HAEIN

3

488

S=910 I=37 E=1.738e-101

Xylulose kinase EC=2.7.1.17 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

sp_Pdown

sp|Q9RK00|XYLB_STRCO

3

427

S=578 I=36 E=2.83618e-61

Xylulose kinase EC=2.7.1.17 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

sp_Pdown

sp|P27156|XYLB_STRRU

3

427

S=545 I=36 E=2.82672e-57

Xylulose kinase EC=2.7.1.17 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

sp_Pdown

sp|P39211|XYLB_BACSU

1

421

S=514 I=32 E=1.66971e-53

Xylulose kinase EC=2.7.1.17 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

sp_Pdown

sp|P29444|XYLB_KLEPN

3

420

S=472 I=32 E=1.86231e-48

Xylulose kinase EC=2.7.1.17 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

PD001007

317

385

S=164 I=46 E=2.90563e-12

PD024458

136

194

S=156 I=48 E=2.8037e-11

PDA1R628

283

308

S=140 I=100 E=2.33072e-09

PD869475

328

418

S=115 I=33 E=2.62671e-06

PD191435

219

287

S=109 I=46 E=1.38879e-05

PDA772Q0

196

217

S=105 I=95 E=3.40914e-05

PDA321L2

196

218

S=102 I=87 E=8.08182e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one vz6bYnEc)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

57 hits
swiss-prot

Swiss-Prot ncbi-blastp

156 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr27370.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr27370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr27370.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr27370.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
xylA2 XFF4834R_chr41000
XFF4834R_chr_4380
XFF4834R_chr_4380
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr41010
XFF4834R_chr41010
ID xylA2
AC XFF4834R_chr41000
LT XFF4834R_chr41000
OR XFF4834R_chr from 4757765 to 4759102 on strand +
DE probable D-xylose isomerase
IP Xylose isomerase; Xylose isomerase, bacterial type
CL 1.1.1.19 Xylose catabolism GO:0042843
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: xylose isomerase activity (GO:0009045)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100719)
MW 48807 Da
SQ 445 aa
 
........10........20........30........40........50
| | | | |
MSNTVYIGAKEYFPGIGQIGFEGRDSDNPLAFKVYDANKTIGDKTMAEHL
RFAVAYWHSFCGNGADPFGPGTRAYPWDVGDTALNRAEAKADAAFEFFTK
LGVPYYCFHDIDLSPDADDIGQYESNLKHMVGIAKQRQADTGIKLLWGTA
NLFSHPRYMNGASTNPDFNVVARAAVQVKAAIEATVELGGENYVFWGGRE
GYACLHNTQMKREQDNMARFLTLARDYGRSLGFKGNFLIEPKPMEPMKHQ
YDFDSATVIGFLRQHGLDQDFKLNIEANHATLSGHSFEHDLQVASDAGLL
GSIDANRGNPQNGWDTDQFPTDLYDTVGAMLVVLRQGGLAPGGLNFDAKV
RRESSDPQDLFLAHIGGMDAFARGLEVANALLTASPLEQWRAERYASFDS
GAGADFAAGKTTLADLAKHAAGNAPQQISGRQEAYENLINQYLTR
Show or not Domain decomposition
 
XFF4834R

XFF4834R_chr27360 lcl|xylA-XFF4834R_chr27360

1

445

S=2138 I=90 E=0

D-xylose isomerase

XFF4834R

NP_644524.2 lcl|xylA-XAC4225

1

445

S=2126 I=89 E=0

xylose isomerase

XFF4834R

NP_642104.2 lcl|xylA-XAC1776

1

445

S=2117 I=89 E=0

xylose isomerase

XFF4834R

YP_366061.1 lcl|xylA-XCV4330

1

445

S=2111 I=89 E=0

xylose isomerase

XFF4834R

YP_363539.1 lcl|XCV1808

1

445

S=2111 I=89 E=0

xylose isomerase

XFF4834R

NP_639439.1 lcl|xylA-XCC4100

1

445

S=2027 I=85 E=0

xylose isomerase

XFF4834R

NP_637125.1 lcl|xylA-XCC1758

1

445

S=2013 I=84 E=0

xylose isomerase

XFF4834R

lcl|xylA1-XALc_1196

1

445

S=1920 I=80 E=0

probable xylose isomerase protein

XFF4834R

lcl|xylA2-XALc_0064

1

445

S=1920 I=80 E=0

probable xylose isomerase protein

pubmed

9

442

S=1295 I=55 E=5.01224e-148

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Metal-binding Pentose shunt

Pubmed 12811467

 

prodomImg

pubmed

10

442

S=1283 I=55 E=1.30673e-146

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Metal-binding Pentose shunt

Pubmed 19050860

 

prodomImg

pubmed

10

443

S=1087 I=47 E=7.07943e-123

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

Pubmed 1324398

 

prodomImg

pubmed

12

443

S=1080 I=50 E=5.2589e-122

Xylose kinase

Pubmed 8031084,10368143

 

prodomImg

pubmed

12

443

S=1080 I=47 E=5.83892e-122

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

Pubmed 6320721,6327696

 

prodomImg

sp_Pdown

sp|Q8PEW5|XYLA2_XANAC

1

445

S=2126 I=89 E=0

Xylose isomerase 2 EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

sp_Pdown

sp|Q3BMF2|XYLA_XANC5

1

445

S=2111 I=89 E=0

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

sp_Pdown

sp|Q2NXR2|XYLA_XANOM

1

445

S=2100 I=88 E=0

Xylose isomerase EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

sp_Pdown

sp|Q5GUF2|XYLA2_XANOR

1

445

S=2100 I=88 E=0

Xylose isomerase 2 EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

sp_Pdown

sp|Q5GYQ7|XYLA1_XANOR

1

445

S=2100 I=88 E=0

Xylose isomerase 1 EC=5.3.1.5 ; Carbohydrate metabolism Cytoplasm Magnesium Metal-binding Pentose shunt

Iprscan IPR001998 [PR00688]

100

122

Xylose isomerase

Iprscan IPR001998 [PR00688]

141

161

Xylose isomerase

Iprscan IPR001998 [PR00688]

164

183

Xylose isomerase

Iprscan IPR001998 [PR00688]

188

209

Xylose isomerase

Iprscan IPR001998 [PR00688]

215

234

Xylose isomerase

Iprscan IPR001998 [PR00688]

237

261

Xylose isomerase

Iprscan IPR001998 [PR00688]

279

306

Xylose isomerase

Iprscan IPR001998 [PR00688]

308

319

Xylose isomerase

Iprscan IPR001998 [PR00688]

341

352

Xylose isomerase

Iprscan IPR013022 [G3DSA:3.20.20.150]

10

443

Xylose isomerase-like, TIM barrel domain

Iprscan IPR001998 [MF_00455]

19

443

Xylose isomerase

Iprscan IPR012307 [PF01261]

91

317

Xylose isomerase, TIM barrel domain

Iprscan IPR013452 [TIGR02630]

12

443

Xylose isomerase, bacterial type

Iprscan IPR001998 [PS51415]

43

443

Xylose isomerase

Iprscan [seg]

87

98

-

Iprscan [seg]

170

184

-

Iprscan [seg]

396

409

-

PD003353

18

444

S=1147 I=52 E=1.89612e-131

Iprscan IPR013022 [SSF51658]

10

443

Xylose isomerase-like, TIM barrel domain

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one LrLhutSD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

40 hits
swiss-prot

Swiss-Prot ncbi-blastp

195 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

2 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

18 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr41000.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr41000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr41000.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr41000.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
xylB2 XFF4834R_chr41180
XFF4834R_chr41170
XFF4834R_chr41170
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr41190
XFF4834R_chr41190
ID xylB2
AC XFF4834R_chr41180
LT XFF4834R_chr41180
OR XFF4834R_chr from 4781896 to 4783542 on strand -
DE putative D-xylulose kinase
IP
CL 1.1.1.19 Xylose catabolism GO:0042843
EC
GO InterPro


Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: XFF4834R
CC STATUS: curated by elauber (20100716)
MW 59512.7 Da
SQ 548 aa
 
........10........20........30........40........50
| | | | |
MRTQTLADDTGGNAPLVLAVDLGTSGCKCALVTLDGKVLAWAFEPVQLHV
QGVAAEQDPHAWWDAFCATAAAVVQGDAALRRRVVAVCCSTQGEGTVCVD
HNGQALGRAMLWLDMRGQAAIARRLQGRWLNVRGYDPLRLWRWLRLSGGA
PARSGKDCAGHIAYLRDHQPVRYERTHKFLNVLDYMNLRLTGRFCATPDS
MLTTWVTDNRDPHHIRYDAGLLDMVGVERDKLPDLLPSTAVLGPLLPQVA
EALGLSPQTVVVAGAIDTSAVAVAAAVEDHAAHLYLGTSSWLGAHVPRMK
TDVRSTIAAVPCAVEGRYLAIALQTTAGANLSFLRDRILFHADELLSDEQ
RPDVYEVLNRIAARVPAGSNGLIYMPWLFGERTPVEDPSLRAGLINLSLM
HSREDMIRAVMEGVAFNTRWMMEPFARLLGCDPGTIAAVGGGAQSDLWCQ
IIADVSGRPIRQLHNPIQANAVGAAFIAGVGLGRLGFGDLAALQRPRRVY
EPDAGTRALYDDRYAVFKDLQRTLAPIYRRLNPSTPAPAQEVAAHVCP
XFF4834R

XFF4834R_chr27370 lcl|xylB-XFF4834R_chr27370

159

528

S=162 I=27 E=8.06817e-13

xylulokinase

XFF4834R

XFF4834R_chr03420 lcl|glpK-XFF4834R_chr03420

367

524

S=107 I=26 E=3.78963e-06

glycerol kinase

XFF4834R

YP_366081.1 lcl|xylB4-XCV4350

1

548

S=2563 I=90 E=0

xylulose kinase

XFF4834R

NP_644543.2 lcl|xylB-XAC4244

1

548

S=2559 I=91 E=0

xylulose kinase

XFF4834R

lcl|xylB-XALc_1195

81

480

S=179 I=29 E=2.17521e-14

probable xylulose kinase protein

XFF4834R

NP_642103.1 lcl|XAC1775-XAC1775

159

528

S=162 I=27 E=2.87041e-12

D-xylulokinase

XFF4834R

YP_363538.1 lcl|XCV1807

159

528

S=161 I=27 E=3.47733e-12

putative xylulose kinase

XFF4834R

NP_637124.1 lcl|XCC1757

80

478

S=159 I=25 E=5.97049e-12

D-xylulokinase

XFF4834R

NP_635753.1 lcl|glpK-XCC0358

367

503

S=115 I=27 E=1.39725e-06

glycerol kinase

XFF4834R

YP_362103.1 lcl|glpK-XCV0372

367

502

S=112 I=27 E=3.17107e-06

glycerol kinase

XFF4834R

lcl|glpK-XALc_0443

367

483

S=112 I=27 E=3.2551e-06

probable glycerol kinase protein

XFF4834R

NP_640714.1 lcl|glpK-XAC0358

367

510

S=108 I=27 E=1.01999e-05

glycerol kinase

pubmed

18

531

S=389 I=27 E=3.40624e-38

Xylulose kinase ; Transferase

Pubmed 1368665,9495747

 

prodomImg

pubmed

17

536

S=360 I=27 E=1.09289e-34

Xylose isomerase ; Kinase Transferase

Pubmed 8031084,10368143

 

prodomImg

pubmed

17

520

S=355 I=26 E=5.38901e-34

Xylulose kinase EC=2.7.1.17 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

Pubmed 2994009

 

prodomImg

pubmed

14

527

S=344 I=25 E=1.01756e-32

Xylulose kinase EC=2.7.1.17 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

Pubmed 1660563

 

prodomImg

pubmed

17

531

S=310 I=23 E=1.43738e-28

D-xylulose kinase EF0083 ; Transferase

Pubmed 12066186

 

prodomImg

sp_Pdown

sp|P39211|XYLB_BACSU

17

520

S=355 I=26 E=3.66816e-34

Xylulose kinase EC=2.7.1.17 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

sp_Pdown

sp|Q5HL88|XYLB_STAEQ

16

522

S=345 I=26 E=5.2859e-33

D-xylulose kinase EC=2.7.1.- ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

sp_Pdown

sp|P21939|XYLB_LACPE

14

527

S=344 I=25 E=6.92629e-33

Xylulose kinase EC=2.7.1.17 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

sp_Pdown

sp|Q8CR47|XYLB_STAES

16

522

S=343 I=26 E=1.07109e-32

D-xylulose kinase EC=2.7.1.- ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

sp_Pdown

sp|P35850|XYLB_LACBR

17

531

S=308 I=24 E=1.78558e-28

Xylulose kinase EC=2.7.1.17 ; ATP-binding Carbohydrate metabolism Nucleotide-binding Transferase Xylose

PD986736

303

352

S=254 I=100 E=3.30601e-23

PD659906

424

467

S=210 I=89 E=5.75211e-18

PDA256J7

420

532

S=203 I=40 E=5.13145e-17

PDA3A7G1

82

246

S=188 I=35 E=2.88141e-15

PD001007

355

423

S=163 I=49 E=3.54318e-12

PD869475

331

462

S=115 I=30 E=2.40221e-06

PD298402

405

461

S=113 I=37 E=3.34579e-06

PD708303

124

161

S=112 I=61 E=4.23383e-06

PD557873

405

486

S=107 I=28 E=1.86397e-05

PD986756

433

524

S=106 I=34 E=2.44243e-05

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one RiZ4xB4X)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

46 hits
swiss-prot

Swiss-Prot ncbi-blastp

360 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

0 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr41180.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr41180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr41180.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBKskEL7/XFF4834R_chr41180.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.