Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr40590XFF4834R_chr_4693712_4694071_r3_XFF4834R-XFF4834R_chr40590XFF4834R_chr40590hypothetical protein

XFF4834R_chr_4693712_4694071_r3_XFF4834R-XFF4834R_chr40590 XFF4834R_chr40590
XFF4834R_chr40580
XFF4834R_chr40580
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr40600
XFF4834R_chr40600
ID XFF4834R_chr_4693712_4694071_r3_XFF4834R-XFF4834R_chr40590
AC XFF4834R_chr40590
LT XFF4834R_chr40590
OR XFF4834R_chr from 4693712 to 4694071 on strand -
DE hypothetical protein
IP Rhamnose mutarotase
CL 1.1.1.16 Rhamnose catabolism GO:0019301
EC
GO InterPro
Biological Process: rhamnose metabolic process (GO:0019299)
Cellular Component: cytoplasm (GO:0005737)
acting on carbohydrates and derivatives (GO:0016857)

Curated
PM
AN
CC COG: [S] Function unknown;
CC MODEL: XFF4834R
CC STATUS: curated by jacques (20100909)
MW 13777.6 Da
SQ 119 aa
 
........10........20........30........40........50
| | | | |
MPRLCYVLDLHDDAALIAEYERWHQPTEVWPEVVASLQQAGILELEIFRS
GDRLVMLMQVREDYDPAAKAARDAADPRIQAWEQLMWRFQKPLPGSTQGE
KWRQAGRIFALSEAIDAQR
XFF4834R

NP_644488.1 XAC4189-XAC4189

1

119

S=501 I=83 E=2.48031e-54

hypothetical protein

XFF4834R

YP_366019.1 XCV4288

1

119

S=495 I=82 E=1.5612e-53

hypothetical protein

XFF4834R

NP_639409.1 XCC4070

1

119

S=456 I=75 E=6.6735e-49

hypothetical protein

XFF4834R

XALc_0449 XALc_0449

1

118

S=385 I=62 E=3.35538e-40

hypothetical protein

sp_Pdown

sp|Q556R9|Y3871_DICDI

7

112

S=117 I=30 E=2.05413e-06

UPF0734 protein DDB_G0273871/DDB_G0273177

Iprscan IPR008000 [PF05336]

3

111

Rhamnose mutarotase

Iprscan [seg]

65

78

-

PDA4L160

20

118

S=164 I=37 E=1.84051e-12

PD769083

87

119

S=150 I=88 E=9.14731e-11

PD030108

1

57

S=126 I=46 E=7.73146e-08

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one HFJcLDWD)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

0 hits
swiss-prot

Swiss-Prot ncbi-blastp

1 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

0 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

2 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3C9Zph/XFF4834R_chr40590.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3C9Zph/XFF4834R_chr40590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3C9Zph/XFF4834R_chr40590.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB3C9Zph/XFF4834R_chr40590.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.