Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr15580XFF4834R_chr16810060_1802750_r2_XFF4834R-XFF4834R_chr15580XFF4834R_chr15580putative beta-mannosidase

XFF4834R_chr16810060_1802750_r2_XFF4834R-XFF4834R_chr15580 XFF4834R_chr15580
XFF4834R_chr15570
XFF4834R_chr15570
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr15590
XFF4834R_chr15590
ID XFF4834R_chr16810060_1802750_r2_XFF4834R-XFF4834R_chr15580
AC XFF4834R_chr15580
LT XFF4834R_chr15580
OR XFF4834R_chr from 1800060 to 1802750 on strand -
DE putative beta-mannosidase
IP Glycoside hydrolase family 2, TIM barrel; Glycoside hydrolase family 2, carbohydrate-binding
CL 1.1.1.15 Mannose catabolism GO:0019309
EC
GO InterPro
Biological Process: carbohydrate metabolic process (GO:0005975)
Molecular Function: catalytic activity (GO:0003824)
Molecular Function: cation binding (GO:0043169)
hydrolyzing O-glycosyl compounds (GO:0004553)

Curated
PM
AN
CC COG: [G] Carbohydrate transport and metabolism;
CC MODEL: acur
CC STATUS: curated by pieretti (20100413)
MW 100513 Da
SQ 896 aa
 
........10........20........30........40........50
| | | | |
MPLSRHRCVPAPARLGLALAVAISQAWAAPPTATPLDSGWQVRLVPGQEQ
ARTYPKAAAWLPAQVPGAVQTDLIAAKIVPDPFYRDNEGKIQWAGLSDWQ
YQTRFNVDAATLKREHVELVFDGLDTFAEVTLNGKPLLSADNMFRQWRVD
AKPLLKRGDNVLEVKLFSPIKKIQPWLAKQPYALPGAYDSAFGDEPESRH
SSTYVRKAPYNFGWDWGPRMVNAGIWKDVRMEAWDAVRVDGLHIAQQRVD
ADSAQLQAQLELQAGRSGPVQVTLDVLGPDGQKVGQFTQQAVVDPGQNRI
DLPVRIAKPKRWFPAGYGAQDRYTFVASVRDADGDSQQIKRVTGLRSVEL
RREKDKYGKSMEIVINGIPIFAKGANLIPLDAFPARVSPERMRSTLQDAR
DANMNMLRMWGGGHYQYDRFYEVADELGIMIWQDFMFGGAVPPYDVEFRE
NTRQEAIEQVKRLRDHPSIVLWCGNNEVQTGWENWGDRVKFKQSVDPEER
SRIERGMTTLFGTVFREVVATYDSDVPYWSTSPGTNFDGAADQANDGDMH
YWKVWGGPALPVTEYLNVTPRFMSEYGLQSFPDMRTVRAFAEPGDMDPES
PVMRVHQKFDKGNGNKRLMLYIRREFGEPKDFESFVYLSQLMQAEGINLA
ASHLRASRPQSMGSLYWQLNDVWPGASWSSVDYDGRWKALHYHARRFYAP
EMIAALRNDKGQTEVSLVSDRTTPLAARWRMRVMNMDGKVLSKREEKASV
KALSSLQVGNFSDKQLLGSADPKRTYAVFELFDGDTLLSREVVFFAPAKQ
LALPAAKIDGQWRTNGDGYALTLTSNTLAREVWLSFGDVDATLSDNAFDL
LPGEPLTVHVSSKLPLAQVQAALQVRDLGSTLAGAPAEPQEEAAAK
XFF4834R

XFF4834R_chr13290 lcl|XFF4834R_chr14140724_1525191_f1_XFF4834R-XFF4834R_chr13290

18

348

S=202 I=27 E=1.57386e-17

XFF4834R

XFF4834R_chr13290 lcl|XFF4834R_chr14140724_1525191_f1_XFF4834R-XFF4834R_chr13290

327

477

S=187 I=35 E=1.22021e-15

XFF4834R

XFF4834R_chr13290 lcl|XFF4834R_chr14140724_1525191_f1_XFF4834R-XFF4834R_chr13290

561

746

S=136 I=27 E=1.59088e-09

XFF4834R

YP_364941.1 lcl|manB-XCV3210

1

882

S=4304 I=92 E=0

beta-mannosidase precursor

XFF4834R

NP_638239.1 lcl|XCC2891

1

882

S=4301 I=91 E=0

beta-mannosidase

XFF4834R

NP_643384.1 lcl|XAC3075-XAC3075

1

882

S=4218 I=91 E=0

beta-mannosidase

XFF4834R

lcl|XALc_2220

8

882

S=3491 I=75 E=0

putative beta-mannosidase; beta-galactosidase/beta-glucuronidase protein

XFF4834R

NP_643619.2 lcl|XAC3312-XAC3312

57

348

S=211 I=28 E=5.21992e-18

glycosyl hydrolase

XFF4834R

NP_643619.2 lcl|XAC3312-XAC3312

327

477

S=177 I=33 E=6.75785e-14

glycosyl hydrolase

XFF4834R

NP_643619.2 lcl|XAC3312-XAC3312

561

746

S=127 I=27 E=8.81077e-08

glycosyl hydrolase

XFF4834R

YP_365161.1 lcl|XCV3430

58

348

S=204 I=28 E=3.55382e-17

putative O-glycosyl hydrolase

XFF4834R

YP_365161.1 lcl|XCV3430

327

477

S=183 I=34 E=1.4441e-14

putative O-glycosyl hydrolase

XFF4834R

YP_365161.1 lcl|XCV3430

561

746

S=138 I=28 E=3.95383e-09

putative O-glycosyl hydrolase

pubmed

61

762

S=1022 I=36 E=1.26487e-114

Beta-mannosidase Man2 ; Glycosidase Hydrolase

Pubmed 11590605

 

prodomImg

pubmed

34

743

S=947 I=35 E=1.26639e-105

Beta-mannosidase

Pubmed 17005978

 

prodomImg

pubmed

61

848

S=920 I=31 E=2.47196e-102

Beta-mannosidase EC=3.2.1.25 ; Glycosidase Hydrolase

Pubmed 10594236

 

prodomImg

pubmed

61

881

S=918 I=31 E=4.31895e-102

Beta-mannosidase EC=3.2.1.25 ; Glycoprotein Glycosidase Hydrolase Lysosome Polymorphism Signal

Pubmed 7876128

 

prodomImg

pubmed

61

881

S=918 I=31 E=4.96549e-102

Beta-mannosidase EC=3.2.1.25 ; Glycoprotein Glycosidase Hydrolase Lysosome Polymorphism Signal

Pubmed 8921369

 

prodomImg

pubmed

61

848

S=890 I=31 E=1.18447e-98

Beta-mannosidase EC=3.2.1.25 ; Glycoprotein Glycosidase Hydrolase Lysosome Polymorphism Signal

Pubmed 9384606

 

prodomImg

pubmed

61

881

S=878 I=30 E=3.1976e-97

Beta-mannosidase EC=3.2.1.25 ; Glycoprotein Glycosidase Hydrolase Lysosome Signal

Pubmed 11892998

 

prodomImg

pubmed

59

707

S=847 I=33 E=1.76153e-93

Beta-mannosidase

Pubmed 16844780

 

prodomImg

pubmed

36

863

S=839 I=31 E=1.93722e-92

Mannosidase

Pubmed 10347049

 

prodomImg

pubmed

65

721

S=575 I=26 E=1.83744e-60

Probable beta-mannosidase EC=3.2.1.25 ; Glycoprotein Glycosidase Hydrolase Lysosome Signal

Pubmed 17761667

 

prodomImg

Iprscan [G3DSA:2.60.120.260]

34

166

-

Iprscan IPR013781 [G3DSA:3.20.20.80]

363

497

Glycoside hydrolase, subgroup, catalytic core

Iprscan IPR006104 [PF02837]

30

235

Glycoside hydrolase family 2, carbohydrate-binding

Iprscan IPR006103 [PF02836]

359

612

Glycoside hydrolase family 2, TIM barrel

Iprscan [seg]

254

264

-

Iprscan [seg]

794

807

-

Iprscan [seg]

883

895

-

PD014562

433

721

S=659 I=48 E=2.98949e-72

PD856824

711

863

S=387 I=55 E=2.90823e-39

PD018561

36

100

S=169 I=51 E=8.17271e-13

PDA1F9O7

386

432

S=168 I=60 E=9.07411e-13

PDA1L658

170

205

S=166 I=83 E=1.61329e-12

PDA3E8G1

512

549

S=162 I=79 E=4.88202e-12

PD715581

306

379

S=156 I=48 E=2.71983e-11

PD402678

203

246

S=155 I=59 E=4.09739e-11

PDA3E8F7

478

511

S=155 I=82 E=4.27996e-11

PD919420

1

34

S=150 I=91 E=1.43802e-10

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one nu5pxvCk)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

18 hits
swiss-prot

Swiss-Prot ncbi-blastp

10 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

7 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBS_iZKh/XFF4834R_chr15580.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBS_iZKh/XFF4834R_chr15580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBS_iZKh/XFF4834R_chr15580.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WBS_iZKh/XFF4834R_chr15580.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.