Xanthomonas fuscans subsp. fuscans

  1. XFF4834R_chr27470dgoDXFF4834R_chr27470probable galactonate dehydratase

dgoD XFF4834R_chr27470
XFF4834R_chr27460
XFF4834R_chr27460
Cluster
DrawMap
XML file

FASTA file
Extract
Sequence
Codon
Usage
Framed OrthoMCL XFF4834R_chr27480
XFF4834R_chr27480
ID dgoD
AC XFF4834R_chr27470
LT XFF4834R_chr27470
OR XFF4834R_chr from 3178097 to 3179245 on strand +
DE probable galactonate dehydratase
IP O-succinylbenzoic acid (OSB) synthetase, low GC Gram-positive bacteria/archaea; Mandelate racemase/muconate lactonizing enzyme, conserved site
CL 1.1.1.13 Galactonate catabolism GO:0019584
EC
GO InterPro
Biological Process: metabolic process (GO:0008152)
Biological Process: cellular amino acid catabolic process (GO:0009063)
Molecular Function: catalytic activity (GO:0003824)

Curated
PM
AN
CC COG: [MR] Cell wall/membrane/envelope biogenesis;General function prediction only;
CC MODEL: XFF4834R
CC STATUS: curated by irobene (20100823)
MW 41911.5 Da
SQ 382 aa
 
........10........20........30........40........50
| | | | |
MKITRLTTYHAAPRWLFLKVETDEGITGWGEPVIEGRARSVEAAVHELAG
YVVGKDPARINDLWQTLYRAGFYRGGAILMSAIAGIDQALWDIKGKALGV
PVYELLGGLVRDRMKTYRWVGGDRPGAIIQQITDYRALGFDTFKFNGTEE
MKLIDSARAVDAAVVKVAEIREAFGNSIDFGIDFHGRVGAPMAKALLREL
EPFKPLFVEEPVLAEQAEYYPRLAASTSIPLAAGERMFSRFEFKNVLCAG
GIGMVQPDLSHAGGITECVKIAAMAEAYDVGFAPHCPLGPIALAACLHVD
FVSHNAVLQEQSIGIHYNEGADLLDYVVNKDDFHCVDGSIAALPKPGLGV
EIDEEMLKRANENPPDWRNPVWRHSDGSIAEW
XFF4834R

XFF4834R_chr41040 lcl|rspA-XFF4834R_chr41040

15

140

S=245 I=40 E=4.35759e-23

predicted dehydratase

XFF4834R

XFF4834R_chr41040 lcl|rspA-XFF4834R_chr41040

169

382

S=200 I=28 E=1.04682e-17

predicted dehydratase

XFF4834R

XFF4834R_chr40580 lcl|XFF4834R_chr_4692124_4693446_f1_XFF4834R-XFF4834R_chr40580

171

313

S=135 I=27 E=9.95489e-10

XFF4834R

YP_363527.1 lcl|dgoD-XCV1796

1

382

S=1943 I=96 E=0

galactonate dehydratase

XFF4834R

NP_642093.1 lcl|dgoA-XAC1765

1

382

S=1940 I=96 E=0

4-hydroxy-2-oxoglutarate aldolase/2-deydro-3-deoxyphosphogluconate aldolase

XFF4834R

NP_637113.1 lcl|dgoA-XCC1746

1

382

S=1912 I=94 E=0

4-hydroxy-2-oxoglutarate aldolase/2-deydro-3- deoxyphosphogluconate aldolase

XFF4834R

lcl|dgoD-XALc_1189

1

382

S=1708 I=84 E=0

probable galactonate dehydratase protein

XFF4834R

NP_639443.1 lcl|rspA-XCC4104

15

140

S=246 I=40 E=1.08437e-22

starvation sensing protein

XFF4834R

NP_639443.1 lcl|rspA-XCC4104

169

382

S=204 I=29 E=1.33119e-17

starvation sensing protein

XFF4834R

YP_366066.1 lcl|rspA-XCV4335

15

140

S=246 I=40 E=1.27973e-22

starvation sensing protein

XFF4834R

YP_366066.1 lcl|rspA-XCV4335

169

382

S=204 I=29 E=1.29682e-17

starvation sensing protein

XFF4834R

NP_644528.1 lcl|rspA-XAC4229

15

140

S=245 I=40 E=1.6194e-22

starvation sensing protein

XFF4834R

NP_644528.1 lcl|rspA-XAC4229

169

382

S=207 I=29 E=5.91689e-18

starvation sensing protein

XFF4834R

lcl|rspA-XALc_0060

15

140

S=235 I=38 E=2.45892e-21

probable starvation-sensing protein

XFF4834R

lcl|rspA-XALc_0060

169

382

S=197 I=29 E=1.06029e-16

probable starvation-sensing protein

XFF4834R

NP_644487.1 lcl|XAC4188-XAC4188

171

313

S=140 I=27 E=8.04463e-10

RTS beta protein

XFF4834R

YP_366018.1 lcl|XCV4287

171

313

S=140 I=27 E=8.11508e-10

putative mandelate racemase/muconate lactonizing enzyme

XFF4834R

lcl|XALc_0448

171

313

S=134 I=27 E=4.1798e-09

putative mandelate racemase/muconate lactonizing enzyme protein

XFF4834R

NP_639408.1 lcl|XCC4069

171

313

S=134 I=27 E=4.1798e-09

RTS beta protein

XFF4834R

NP_639152.1 lcl|tcbD-XCC3807

4

278

S=125 I=24 E=4.84355e-08

chloromuconate cycloisomerase

pubmed

1

382

S=1512 I=71 E=1.96174e-174

D-galactonate dehydratase EC=4.2.1.6 ; Lyase Magnesium Metal-binding

Pubmed 7686882

 

prodomImg

pubmed

1

382

S=1165 I=59 E=2.10304e-132

L-alanine-DL-glutamate epimerase

Pubmed 15305924

 

prodomImg

pubmed

1

381

S=520 I=34 E=3.53389e-54

Putative uncharacterized protein

Pubmed 15231388

 

prodomImg

pubmed

16

372

S=450 I=32 E=9.56754e-46

Gluconate dehydratase EC=4.2.1.39 ; Lyase

Pubmed 15028704

 

prodomImg

pubmed

1

382

S=443 I=35 E=5.96989e-45

Putative isomerase ; Metal-binding

Pubmed 18791008

 

prodomImg

sp_Pdown

sp|Q3BUN6|DGOD_XANC5

1

382

S=1943 I=96 E=0

D-galactonate dehydratase EC=4.2.1.6 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|Q8PLN0|DGOD_XANAC

1

382

S=1940 I=96 E=0

D-galactonate dehydratase EC=4.2.1.6 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|B2SV55|DGOD_XANOP

1

382

S=1936 I=96 E=0

D-galactonate dehydratase EC=4.2.1.6 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|Q2P1Q3|DGOD_XANOM

1

382

S=1936 I=96 E=0

D-galactonate dehydratase EC=4.2.1.6 ; Lyase Magnesium Metal-binding

sp_Pdown

sp|Q8P9V1|DGOD_XANCP

1

382

S=1912 I=94 E=0

D-galactonate dehydratase EC=4.2.1.6 ; Lyase Magnesium Metal-binding

Iprscan [G3DSA:3.20.20.120]

90

379

-

Iprscan [MF_01289]

1

382

-

Iprscan [PTHR13794:SF4]

64

377

-

Iprscan IPR001354 [PTHR13794]

64

377

Mandelate racemase/muconate lactonizing enzyme

Iprscan IPR013341 [PF02746]

7

107

Mandelate racemase/muconate lactonizing enzyme, N-terminal

Iprscan IPR013342 [PF01188]

126

230

Mandelate racemase/muconate lactonizing enzyme, C-terminal

Iprscan IPR018110 [PS00908]

82

107

Mandelate racemase/muconate lactonizing enzyme, conserved site

Iprscan IPR018110 [PS00909]

180

211

Mandelate racemase/muconate lactonizing enzyme, conserved site

Iprscan [seg]

157

168

-

PDA2T2X9

99

156

S=309 I=100 E=6.66744e-30

PD308314

34

98

S=177 I=54 E=6.63656e-14

PDA1G4Y0

1

33

S=142 I=70 E=1.14562e-09

PD338790

261

354

S=133 I=41 E=1.33917e-08

PDA0T1Q3

16

115

S=119 I=33 E=6.59788e-07

PDA5P004

99

141

S=109 I=47 E=1.06488e-05

PDA5P0H1

16

121

S=108 I=30 E=1.29004e-05

PDA1V374

361

382

S=104 I=73 E=5.02686e-05

Iprscan [SSF51604]

110

359

-

Iprscan [SSF54826]

1

107

-

Show or not Suggestions

Suggest an annotation

Move your mouse over each field to get more informations

ID
DE
EC
GO
PM
CC
CL
  Your email
  Validation code (copy this one rmPuGGqn)
   

Show or not Access unfiltered results

pubmed

Set of Uniprot with relevant PubMed cross-references ncbi-blastp

35 hits
swiss-prot

Swiss-Prot ncbi-blastp

107 hits
XFF4834R

Xanthomonas fuscans subsp. fuscans proteome ncbi-blastp

3 hits
hamap

HAMAP scan

0 hits
Interpro Scan

IprScan

11 hits

Show or not Miscellaneous analyses

  • ERROR Tag PERLLIB Portal/Tools.pl GetLocalBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4YDBzc/XFF4834R_chr27470.xml_fasta", "https://iant.toulouse.inra.fr/bacteria/annotation/web/img/XFF4834R.png"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetNcbiBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4YDBzc/XFF4834R_chr27470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetUniprotBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4YDBzc/XFF4834R_chr27470.xml_fasta"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.
  • ERROR Tag PERLLIB Portal/Tools.pl GetKeggBlastButton\("/www/bacteria/annotation//site//www/bacteria/annotation//site/tmp/WB4YDBzc/XFF4834R_chr27470.xml_fasta", "blastp"\) - ERROR: No such file or directory at /www/bacteria/annotation/cgi/XFF4834R/../../lib/iANT/Entry/Display.pm line 164.